Recombinant Yersinia Pestis F1 Capsule Antigen (CAF1) Protein (His)

• Purity: Greater than 90% as determined by SDS-PAGE.
• Host Species: Yersinia pestis
• Accession: P26948
• Gene: caf1
• CAT.NO: B000278
• Expression Systems: Yeast
• Product Name: Recombinant Yersinia Pestis F1 Capsule Antigen (CAF1) Protein (His)
• Protein Expression Range: 22-170aa
• Tag: N-terminal 6xHis-tagged
• Molecular Mass: 17.6kDa
• Form: Liquid or Lyophilized powder
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.; If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Alternative Names: caf1; YPMT1.84; Y1100; YP_pMT082F1 capsule antigen
• Target Protein Sequence: ADLTASTTATATLVEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ
• Protein Length: Full Length of Mature Protein
• Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.; Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week