Recombinant Malaria protein EXP-1 (EXP-1)

  • Host Species: Plasmodium falciparum
  • Accession: P04926
  • CAT.NO: B000224
  • Expression Systems:

    In vitro E.coli expression system

Inquiry Now

This protein is directed to a novel compartment within the cytoplasm of the infected red blood cell and surrounds the parasite, likely within the parasitophorous vacuole membrane. It plays a role in the interaction between the host cell and the parasite. The protein shares a common epitope with the circumsporozoite protein, suggesting a potential structural or functional similarity between the two. This shared epitope may contribute to immune recognition or response, highlighting the importance of these proteins in the pathogenesis of the infection. Their involvement in parasite survival and host cell manipulation is critical for the infection process.

Product Name Recombinant Malaria protein EXP-1 (EXP-1)
Accession P04926
Host Species Plasmodium falciparum
Source In vitro E.coli expression system
Protein Expression Range 23-162
Tag

Tag type will be determined during the manufacturing process.

Form Lyophilized powder
Buffer

Tris/PBS-based buffer, 6% Trehalose.

Storage

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Alternative Names

EXP-1; Malaria protein EXP-1; Exported antigen AG 5.1

Target Protein Sequence EKTNKETGSGVSSKKKNKKGSGEPLIDVHDLISDMIKKEEELVEVNKRKSKYKLATSVLA GLLGVVSTVLLGGVGLVLYNTEKGRHPFKIGSSDPADNANPDADSESNGEPNADPQVTAQ DVTPEQPQGDDNNLVSGPEH
Protein Length Full Length of Mature Protein
Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Request a Quote