Recombinant Human Tissue factor pathway inhibitor (TFPI), partial (Active)

• Purity: Greater than 95% as determined by SDS-PAGE.
• Host Species: Homo sapiens (Human)
• Accession: P10646
• Gene: TFPI
• CAT.NO: B000224
• Expression Systems: Mammalian cell
• Product Name: Recombinant Human Tissue factor pathway inhibitor (TFPI), partial (Active)
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Protein Expression Range: 29-282aa
• Tag: C-terminal 10xHis-tagged
• Molecular Mass: 31.9 kDa
• Form: Lyophilized powder
• Buffer: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Storage: 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
• Bioactivity: Active
• Target Protein Sequence: DSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIK
• Protein Length: Partial

It directly inhibits factor X (Xa) and, in an Xa-dependent manner, also inhibits VIIa/tissue factor activity, likely by forming a quaternary Xa/LACI/VIIa/TF complex. This mechanism provides an effective antithrombotic action. Additionally, it has the capability to bind with lipoproteins in plasma, further influencing its biological activity. These properties contribute to its role in regulating coagulation and preventing thrombotic events. The compound’s unique interaction with clotting factors highlights its potential as a therapeutic agent in controlling thrombus formation.