It directly inhibits factor X (Xa) and, in an Xa-dependent manner, also inhibits VIIa/tissue factor activity, likely by forming a quaternary Xa/LACI/VIIa/TF complex. This mechanism provides an effective antithrombotic action. Additionally, it has the capability to bind with lipoproteins in plasma, further influencing its biological activity. These properties contribute to its role in regulating coagulation and preventing thrombotic events. The compound’s unique interaction with clotting factors highlights its potential as a therapeutic agent in controlling thrombus formation.
| Product Name | Recombinant Human Tissue factor pathway inhibitor (TFPI), partial |
| Accession | P10646 |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Host Species | Homo sapiens (Human) |
| Gene | TFPI |
| Source | E.coli |
| Protein Expression Range | 29-280aa |
| Tag | N-terminal GST-tagged |
| Molecular Mass | 56.8 kDa |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Research Area | Cardiovascular |
| Target Protein Sequence | DSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGL |
| Protein Length | Partial |
