Recombinant Human Parathyroid hormone/parathyroid hormone-related peptide receptor (PTH1R) , partial

• Purity: Greater than 95% as determined by SDS-PAGE.
• Host Species: Homo sapiens (Human)
• Accession: Q03431
• Gene: PTH1R
• CAT.NO: B000243
• Expression Systems: Mammalian cell
• Product Name: Recombinant Human Parathyroid hormone/parathyroid hormone-related peptide receptor (PTH1R) , partial
• Protein Expression Range: 27-188aa
• Tag: C-terminal 10xHis-tagged
• Molecular Mass: 20.3 kDa
• Form: Liquid or Lyophilized powder
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Target Protein Sequence: DADDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPASIMESDKGWTSASTSGKPRKDKASGKLYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLG
• Protein Length: Partial
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature; and the stability of the protein itself.; Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized; form is 12 months at -20°C/-80°C.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

This receptor binds both parathyroid hormone and parathyroid hormone-related peptide. Its activity is mediated by G proteins, which activate adenylyl cyclase and initiate a phosphatidylinositol-calcium second messenger system. Through these signaling pathways, the receptor plays a key role in regulating various physiological processes, including calcium and phosphate homeostasis. The activation of these intracellular cascades helps modulate cellular responses to parathyroid hormone and related peptides, influencing bone metabolism, renal function, and other important cellular functions.