Recombinant Human/Cynomolgus Activin receptor type-2A (ACVR2A), partial (Active)

  • Purity: Greater than 95% as determined by SDS-PAGE.
  • Host Species: Homo sapiens (Human)
  • Accession: P27037
  • Gene: ACVR2A
  • CAT.NO: B000239
  • Expression Systems:

    Mammalian cell

Inquiry Now

Upon ligand binding, this receptor forms a complex of two type II and two type I transmembrane serine/threonine kinases. The type II receptors phosphorylate and activate the type I receptors, which then autophosphorylate and bind to SMAD transcriptional regulators, initiating gene activation. This receptor specifically binds activin A, activin B, and inhibin A. It plays a role in the induction of adipogenesis by GDF6, contributing to cellular differentiation processes. Through these mechanisms, the receptor regulates important pathways involved in development, metabolism, and tissue formation.

Product Name Recombinant Human/Cynomolgus Activin receptor type-2A (ACVR2A), partial (Active)
Accession P27037
Purity Greater than 95% as determined by SDS-PAGE.
Host Species Homo sapiens (Human)
Gene ACVR2A
Source Mammalian cell
Protein Expression Range 20-135aa
Tag

C-terminal 10xHis-tagged

Molecular Mass 14.8kDa
Form Lyophilized powder
Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Storage

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human ACVR2A at 2 μg/mL can bind Anti-ACVR2A recombinant antibody (CSB-RA623829MA1HU). The EC50 is 3.848-4.375 ng/mL.

Target Protein Sequence AILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPP
Protein Length Partial
Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Request a Quote