Home
>
Recombinant Proteins
>
Recombinant Human/Cynomolgus Activin receptor type-2A (ACVR2A), partial (Active)
Upon ligand binding, this receptor forms a complex of two type II and two type I transmembrane serine/threonine kinases. The type II receptors phosphorylate and activate the type I receptors, which then autophosphorylate and bind to SMAD transcriptional regulators, initiating gene activation. This receptor specifically binds activin A, activin B, and inhibin A. It plays a role in the induction of adipogenesis by GDF6, contributing to cellular differentiation processes. Through these mechanisms, the receptor regulates important pathways involved in development, metabolism, and tissue formation.
Product Name | Recombinant Human/Cynomolgus Activin receptor type-2A (ACVR2A), partial (Active) |
Accession | P27037 |
Purity | Greater than 95% as determined by SDS-PAGE. |
Host Species | Homo sapiens (Human) |
Gene | ACVR2A |
Source | Mammalian cell |
Protein Expression Range | 20-135aa |
Tag | C-terminal 10xHis-tagged |
Molecular Mass | 14.8kDa |
Form | Lyophilized powder |
Buffer | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
Storage | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Bioactivity | Measured by its binding ability in a functional ELISA. Immobilized Human ACVR2A at 2 μg/mL can bind Anti-ACVR2A recombinant antibody (CSB-RA623829MA1HU). The EC50 is 3.848-4.375 ng/mL. |
Target Protein Sequence | AILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPP |
Protein Length | Partial |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |