STIEEQAKTFLDKFNHEAEDLFYQSSLASWN

• CAT Number: I044232
• Molecular Formula: C164H238N40O55
• Molecular Weight: 3649.88
• Purity: ≥95%

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN（Cat No.:I044232）is a synthetic 31-amino acid peptide often used in biochemical and structural biology studies. Its sequence includes a balance of charged, polar, and hydrophobic residues, which makes it suitable for investigating protein–peptide interactions, epitope mapping, and antibody recognition. The peptide’s composition allows it to form secondary structures such as α-helices or β-strands, aiding in conformational studies. It may also serve as a fragment in proteomics research or as a model peptide in binding assays, helping elucidate molecular mechanisms relevant to cell signaling, immune response, or structural dynamics.