Crotamine


CAS No. :

Crotamine,
Product Details
For research use only. Not Intended for Therapeutic Use!
Cat No:P000410
Molecular Formula:C214H326N64O54S7
Molecular Weight:4883.82 Da
Target:Cell-penetrating peptide and ion channels blocker
Price:Get quote
We would like to match the lowest price on market if possible.

Your information is safe with us.

refresh
Appearance: white lyophilized solid
Purity rate: > 95 %
AA sequence: YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG-OH
Length (aa): 41
Cat No:P000410
Product-Name:Crotamine
Crotamine is a basic peptide present in the venom of the South American rattlesnake Crotalus durissus terrificus. Multiple biological functions have been attributed to Crotamine. It is a natural cell-penetrating peptide with selective biological action towards actively proliferating cell types. Moreover, it has been reported that crotamine is a blocker of Kv1.3 (IC50 around 300 nM) as well as Kv1.1 and Kv1.2. It has analgesic properties and myonecrotic effects. In addition, crotamine belongs to the beta-defensin peptides and as such demonstrates antibacterial properties by interacting with lipid membranes.
Recommended Products
  • CAS No. :144161-76-2
    Product Name:

    arginyl-glycyl-aspartyl-tryptophan

    Cat No: M105267 View details
  • CAS No. :146255-33-6
    Product Name:

    2-Propenoic acid, 3-(2-acetylhydrazinyl)-3-amino-, ethyl ester

    Cat No: M105268 View details
  • CAS No. :157439-35-5
    Product Name:

    2H-Azepin-2-one, hexahydro-1-[(2-thioxo-1-pyrrolidinyl)methyl]-

    Cat No: M105269 View details
  • CAS No. :143257-97-0
    Product Name:

    Sameridine

    Cat No: M105272 View details